Protein Info for NIAGMN_22385 in Escherichia coli ECRC102

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01472: GDP-mannose 4,6-dehydratase
  • amino acids 3 to 353 (351 residues), 587.7 bits, E=3.7e-181
• PF01370: Epimerase
  • amino acids 5 to 252 (248 residues), 268.8 bits, E=8.3e-84
• PF04321: RmlD_sub_bind
  • amino acids 6 to 162 (157 residues), 30.5 bits, E=3.9e-11
• PF02719: Polysacc_synt_2
  • amino acids 6 to 117 (112 residues), 24 bits, E=4.1e-09
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 346 (341 residues), 514 bits, E=4.3e-158

Best Hits

Swiss-Prot: 90% identical to GM4D_ECOLI: GDP-mannose 4,6-dehydratase (gmd) from Escherichia coli (strain K12)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 100% identity to ecs:ECs2839)

MetaCyc: 90% identical to GDP-mannose 4,6-dehydratase monomer (Escherichia coli O157:H7)
GDP-mannose 4,6-dehydratase. [EC: 4.2.1.47]

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• GDP-N-acetyl-α-D-perosamine biosynthesis (3/3 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• GDP-D-perosamine biosynthesis (2/2 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (10/14 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (2/3 steps found)
• GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
• GDP-D-rhamnose biosynthesis (1/2 steps found)
• GDP-L-colitose biosynthesis (3/5 steps found)
• GDP-mycosamine biosynthesis (1/3 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.47

Use Curated BLAST to search for 4.2.1.47

Protein Sequence (372 amino acids)

>NIAGMN_22385 GDP-mannose 4,6-dehydratase (Escherichia coli ECRC102)
MTKVALITGVTGQDGSYLAEFLLDKGYEVHGIKRRASSFNTERIDHIYQDPHGSNPNFHL
HYGDLTDSSNLTRILKEVQPDEVYNLAAMSHVAVSFESPEYTADVDAIGTLRLLEAIRFL
GLENKTRFYQASTSELYGLVQEIPQKESTPFYPRSPYAVAKLYAYWITVNYRESYGIYAC
NGILFNHESPRRGETFVTRKITRGLANIAQGLESCLYLGNMDSLRDWGHAKDYVRMQWLM
LQQEQPEDFVIATGVQYSVRQFVEMAAAQLGIKMSFVGKGIEEKGIVDSVEGQDAPGVKP
GDVIVAVDPRYFRPAEVDTLLGDPSKANLKLGWRPEITLAEMISEMVAKDLEAAKKHSLL
KSHGFSVSLALE