Protein Info for NIAGMN_22345 in Escherichia coli ECRC102

Annotation: N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,o ctacis-undecaprenol 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 4 to 189 (186 residues), 55.3 bits, see alignment E=1.9e-18 PF01370: Epimerase" amino acids 5 to 222 (218 residues), 107.1 bits, see alignment E=3.4e-34 PF01073: 3Beta_HSD" amino acids 7 to 206 (200 residues), 95.1 bits, see alignment E=1.4e-30 PF13460: NAD_binding_10" amino acids 9 to 169 (161 residues), 62.8 bits, see alignment E=1.4e-20 PF02719: Polysacc_synt_2" amino acids 23 to 160 (138 residues), 29.2 bits, see alignment E=1.9e-10 PF16363: GDP_Man_Dehyd" amino acids 27 to 235 (209 residues), 59.6 bits, see alignment E=1.4e-19 PF07993: NAD_binding_4" amino acids 58 to 191 (134 residues), 42.8 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 100% identical to GNU_ECO57: N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase (gnu) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to sbc:SbBS512_E1190)

MetaCyc: 100% identical to N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase (Escherichia coli O157)
RXN-14572 [EC: 5.1.3.26]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>NIAGMN_22345 N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,o ctacis-undecaprenol 4-epimerase (Escherichia coli ECRC102)
MNDNVLLIGASGFVGTRLLETAIADFNIKNLDKQQSHFYPEITQIGDVRDQQALDQALAG
FDTVVLLAAEHRDDVSPTSLYYDVNVQGTRNVLAAMEKNGVKNIIFTSSVAVYGLNKHNP
DENHPHDPFNHYGKSKWQAEEVLREWYNKAPTERSLTIIRPTVIFGERNRGNVYNLLKQI
AGGKFMMVGAGTNYKSMAYVGNIVEFIKYKLKNVAAGYEVYNYVDKPDLNMNQLVAEVEQ
SLNKKIPSMHLPYPLGMLGGYCFDILSKITGKKYAVSSVRVKKFCATTQFDATKVHSSGF
VAPYTLSQGLDRTLQYEFVHAKKDDITFVSE