Protein Info for NIAGMN_22295 in Escherichia coli ECRC102

Name: fcl
Annotation: GDP-L-fucose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 66 (62 residues), 28.3 bits, E=1.4e-10
• PF01370: Epimerase
  • amino acids 6 to 227 (222 residues), 216.2 bits, E=7.1e-68
• PF16363: GDP_Man_Dehyd
  • amino acids 39 to 307 (269 residues), 65 bits, E=1.3e-21

Best Hits

Swiss-Prot: 99% identical to FCL_ECOLI: GDP-L-fucose synthase (fcl) from Escherichia coli (strain K12)

KEGG orthology group: K02377, GDP-L-fucose synthase [EC: 1.1.1.271] (inferred from 99% identity to eco:b2052)

MetaCyc: 99% identical to GDP-L-fucose synthase (Escherichia coli K-12 substr. MG1655)
GDP-L-fucose synthase. [EC: 1.1.1.271]

Predicted SEED Role

No annotation

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (10/14 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.271

Use Curated BLAST to search for 1.1.1.271

Protein Sequence (321 amino acids)

>NIAGMN_22295 GDP-L-fucose synthase (Escherichia coli ECRC102)
MSRQRIFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVY
LAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMA
ESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHV
IPALLRRFHEATAQNAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPML
SHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEIS
LEAGLASTYQWFLENQDRFRG