Protein Info for NIAGMN_22260 in Escherichia coli ECRC102

Name: wcaA
Annotation: colanic acid biosynthesis glycosyltransferase WcaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR04017: colanic acid biosynthesis glycosyltransferase WcaA" amino acids 1 to 279 (279 residues), 644.4 bits, see alignment E=1.1e-198 PF13641: Glyco_tranf_2_3" amino acids 7 to 108 (102 residues), 27.3 bits, see alignment E=4.9e-10 PF00535: Glycos_transf_2" amino acids 8 to 169 (162 residues), 115.2 bits, see alignment E=4.8e-37

Best Hits

Swiss-Prot: 100% identical to WCAA_ECOLI: Putative colanic acid biosynthesis glycosyl transferase WcaA (wcaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2059)

MetaCyc: 100% identical to UDP-glucuronate:2-O-Ac-beta-D-Gal-(1->3)-alpha-L-Fuc-(1->4)-2/3-O-Ac-alpha-L-Fuc-(1->3)-beta-D-Glc-PP-Und beta-(1,3)-glucuronosyltranferase (Escherichia coli K-12 substr. MG1655)
2.4.1.-

Predicted SEED Role

"Colanic acid biosynthesis glycosyl transferase WcaA" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>NIAGMN_22260 colanic acid biosynthesis glycosyltransferase WcaA (Escherichia coli ECRC102)
MKDNPLISIYMPTWNRQQLAIRAIKSVLRQDYSNWEMIIVDDCSTSWEQLQQYVTALNDP
RITYIHNDINSGACAVRNQAIMLAQGEYITGIDDDDEWTPNRLSVFLAHKQQLVTHAFLY
ANDYVCQGEVYSQPASLPLYPKSPYSRRLFYKRNIIGNQVFTWAWRFKECLFDTELKAAQ
DYDIFLRMVVEYGEPWKVEEATQILHINHGEMQITSSPKKFSGYFHFYRKHKDKFDRASK
KYQLFTLYQIRNKRMTWRTLLTLLSVRNGKRLADGIRGR