Protein Info for NIAGMN_22250 in Escherichia coli ECRC102

Name: wzb
Annotation: low molecular weight protein-tyrosine-phosphatase Wzb

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 5 to 139 (135 residues), 163.8 bits, E=1.7e-52

Best Hits

Swiss-Prot: 100% identical to WZB_ECOLI: Low molecular weight protein-tyrosine-phosphatase Wzb (wzb) from Escherichia coli (strain K12)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 100% identity to eco:b2061)

MetaCyc: 100% identical to protein-tyrosine phosphatase (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Protein Sequence (147 amino acids)

>NIAGMN_22250 low molecular weight protein-tyrosine-phosphatase Wzb (Escherichia coli ECRC102)
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSL
EGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKS
RETFAAVYTLLERSARQWAQALNAEQV