Protein Info for NIAGMN_22195 in Escherichia coli ECRC102

Name: yegD
Annotation: molecular chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00012: HSP70" amino acids 114 to 212 (99 residues), 37.8 bits, see alignment E=7.6e-14 amino acids 314 to 406 (93 residues), 28.5 bits, see alignment E=4.7e-11 PF06723: MreB_Mbl" amino acids 117 to 213 (97 residues), 27.4 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 99% identical to YEGD_ECOLI: Uncharacterized chaperone protein YegD (yegD) from Escherichia coli (strain K12)

KEGG orthology group: K04046, hypothetical chaperone protein (inferred from 100% identity to ecf:ECH74115_3007)

Predicted SEED Role

"Putative heat shock protein YegD" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>NIAGMN_22195 molecular chaperone (Escherichia coli ECRC102)
MRDGKPHLLKMENDSTLLPSMLCAPTREAVSEWLYRHHDVPADDDETQALLRRAIRYNRE
EDIDVTAKSVQFGLSSLAQYIDDPEEVWFVKSPKSFLGASGLKPQQVALFEDLVCAMMLH
IRQQAQAQLPEAITQAVIGRPINFQGLGGDEANAQAQGILERAAKRAGFRDVVFQYEPVA
AGLDYEATLQEEKRVLVVDIGGGTTDCSLLLMGPQWRSRLDREASLLGHSGCRIGGNDLD
IALAFKNLMPLLGMGGETEKGIALPILPWWNAVAINDVPAQSDFYSSANGRLLNDLVRDA
REPEKVALLQKVWRQRLSYRLVRSAEECKIALSSVAETRASLPFISDELATLISQQGLES
ALSQPLARIQEQVQLALDNAQEKPDVIYLTGGSARSPLIKKALAEQLPGIPIAGGDDFGS
VTAGLARWAEVVFR