Protein Info for NIAGMN_22070 in Escherichia coli ECRC102

Name: gatA
Annotation: PTS galactitol transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF00359: PTS_EIIA_2" amino acids 10 to 132 (123 residues), 77.2 bits, see alignment E=6.4e-26

Best Hits

Swiss-Prot: 100% identical to PTKA_ECOLI: PTS system galactitol-specific EIIA component (gatA) from Escherichia coli (strain K12)

KEGG orthology group: K02773, PTS system, galactitol-specific IIA component [EC: 2.7.1.69] (inferred from 100% identity to eco:b2094)

MetaCyc: 100% identical to galactitol-specific PTS enzyme IIA component (Escherichia coli EC3132)
TRANS-RXN-161 [EC: 2.7.1.200]; TRANS-RXN-169 [EC: 2.7.1.200, 2.7.1.198]

Predicted SEED Role

"PTS system, galactitol-specific IIA component (EC 2.7.1.69)" in subsystem D-Tagatose and Galactitol Utilization (EC 2.7.1.69)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.198 or 2.7.1.200 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>NIAGMN_22070 PTS galactitol transporter subunit IIA (Escherichia coli ECRC102)
MTNLFVRSGISFVDRSEVLTHIGNEMLAKGVVHDTWPQALIAREAEFPTGIMLEQHAIAI
PHCEAIHAKSSAIYLLRPTNKVHFQQADDDNDVAVSLVIALIVENPQQQLKLLRCLFGKL
QQPDIVETLITLPETQLKEYFTKYVLDSDE