Protein Info for NIAGMN_20995 in Escherichia coli ECRC102

Name: eco
Annotation: serine protease inhibitor ecotin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03974: Ecotin" amino acids 30 to 152 (123 residues), 173 bits, see alignment E=1.2e-55

Best Hits

Swiss-Prot: 100% identical to ECOT_ECO5E: Ecotin (eco) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K08276, ecotin (inferred from 99% identity to eco:b2209)

Predicted SEED Role

"Proteinase inhibitor I11, ecotin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>NIAGMN_20995 serine protease inhibitor ecotin (Escherichia coli ECRC102)
MKTILPAVLFAAFATTSAWAAESVQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVEL
LIGQTLEVDCNLHRLGGKLESKTLEGWGYDYYVFDKVSSPVSTMMACPDGKKEKKFVTAY
LGDTGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR