Protein Info for NIAGMN_20895 in Escherichia coli ECRC102

Name: ubiG
Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 16 to 234 (219 residues), 303.9 bits, E=2.8e-95
• PF01209: Ubie_methyltran
  • amino acids 47 to 157 (111 residues), 38.3 bits, E=5.5e-13
• PF08003: Methyltransf_9
  • amino acids 54 to 169 (116 residues), 24.4 bits, E=7.3e-09
• PF05175: MTS
  • amino acids 56 to 127 (72 residues), 26.5 bits, E=2.4e-09
• PF02353: CMAS
  • amino acids 56 to 184 (129 residues), 33.5 bits, E=1.6e-11
• PF13489: Methyltransf_23
  • amino acids 57 to 171 (115 residues), 90.1 bits, E=7.2e-29
• PF06325: PrmA
  • amino acids 57 to 159 (103 residues), 26.3 bits, E=2.8e-09
• PF13847: Methyltransf_31
  • amino acids 57 to 164 (108 residues), 62.2 bits, E=2.7e-20
• PF05401: NodS
  • amino acids 58 to 182 (125 residues), 25.1 bits, E=8e-09
• PF13649: Methyltransf_25
  • amino acids 60 to 153 (94 residues), 69.9 bits, E=1.4e-22
• PF08242: Methyltransf_12
  • amino acids 61 to 154 (94 residues), 58.8 bits, E=4.1e-19
• PF08241: Methyltransf_11
  • amino acids 61 to 157 (97 residues), 77.5 bits, E=5.5e-25

Best Hits

Swiss-Prot: 100% identical to UBIG_ECO5E: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to eco:b2232)

MetaCyc: 100% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (240 amino acids)

>NIAGMN_20895 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Escherichia coli ECRC102)
MNAEKSPVNHNVDHEEIAKFEAVASRWWDLEGEFKPLHRINPLRLSYIAERAGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHA
GQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRM
VPKGTHDVKKFIKPAELLGWVDQTSLKERHITGLHYNPITNTFKLGPGVDVNYMLHTQNK