Protein Info for NIAGMN_20790 in Escherichia coli ECRC102

Name: rhmR
Annotation: Uncharacterized HTH-type transcriptional regulator RhmR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF09339: HTH_IclR" amino acids 9 to 58 (50 residues), 32.3 bits, see alignment 7e-12 PF01614: IclR" amino acids 122 to 247 (126 residues), 146.9 bits, see alignment E=3e-47

Best Hits

Swiss-Prot: 99% identical to RHMR_ECOLI: Uncharacterized HTH-type transcriptional regulator RhmR (rhmR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eok:G2583_2788)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>NIAGMN_20790 Uncharacterized HTH-type transcriptional regulator RhmR (Escherichia coli ECRC102)
MLESSKVPALTRAIDILNLIARIGPCNAATIIDTLGIPKSTAYLLLNELRRQRFLSLDHQ
ENFCLWTKLVELSGHALSKMDLRELARPRLTQLMDTTGLLCHLGIIDNGSAYYILKVESS
ATISVRSHEGKSLSLYRSGIGKCLLAWQPATVQQSIIEGLVWEQATPTTITHPQQLHEEL
ARIRRQGWSYDNGEDYADVRCVAAPVFNANNELTAAISVVGTRLQINEEYRDYLAGKAIA
CARDISRLLGWKSPFDLQAS