Protein Info for NIAGMN_20725 in Escherichia coli ECRC102

Name: menE
Annotation: o-succinylbenzoate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 11 to 317 (307 residues), 161 bits, E=3.9e-51
• TIGR01923: O-succinylbenzoate-CoA ligase
  • amino acids 30 to 443 (414 residues), 369.7 bits, E=1.1e-114
• PF13193: AMP-binding_C
  • amino acids 366 to 423 (58 residues), 29.1 bits, 1.6e-10

Best Hits

Swiss-Prot: 98% identical to MENE_ECOLI: 2-succinylbenzoate--CoA ligase (menE) from Escherichia coli (strain K12)

KEGG orthology group: K01911, O-succinylbenzoic acid--CoA ligase [EC: 6.2.1.26] (inferred from 100% identity to ece:Z3520)

MetaCyc: 98% identical to o-succinylbenzoate--CoA ligase (Escherichia coli K-12 substr. MG1655)
o-succinylbenzoate--CoA ligase. [EC: 6.2.1.26]

Predicted SEED Role

"O-succinylbenzoic acid--CoA ligase (EC 6.2.1.26)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 6.2.1.26)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (7/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.26

Protein Sequence (451 amino acids)

>NIAGMN_20725 o-succinylbenzoate--CoA ligase (Escherichia coli ECRC102)
MIFSDWPWRHWRQVRGEAIALRLNDEQLNWRELCARVDELASGFAVQGVVEDSGVMLRAW
NTPQTLLAWLALLQCGARVLPVNPQLPQPLLEELLPNLTLQFALVPDGENTFPALTSLHI
QRVEGAHVATWQPTRLCSMTLTSGSTGLPKAAVHTYQAHLASAEGVLSLIPFGDHDDWLL
SLPLFHVSGQGIMWRWLYAGARMTVRDKQPLEQMLAGCTHASLVPTQLWRLLVNRSSVSL
KAVLLGGAAIPVELTEQAREQGIRCFCGYGLTEFASTVCAKEADGLADVGSPLPGREVKI
VNNEVWLRAASMAEGYWRNGQLVSLVNYEGWYATRDRGEMHNGKLTIVGRLDNLFFSGGE
GIQTEEVERVIAAHPAVLQVFIVPVADKEFGHRPVAVMEYDHESVDLSEWVKDKLARFQQ
PVRWLTLPPELKNGGIKISRQALKEWVQRQQ