Protein Info for NIAGMN_19980 in Escherichia coli ECRC102

Name: zipA
Annotation: cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 4 to 324 (321 residues), 417.4 bits, see alignment E=2.5e-129 PF04354: ZipA_C" amino acids 198 to 321 (124 residues), 156.8 bits, see alignment E=1.3e-50

Best Hits

Swiss-Prot: 100% identical to ZIPA_SHIDS: Cell division protein ZipA (zipA) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 99% identity to eum:ECUMN_2734)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>NIAGMN_19980 cell division protein ZipA (Escherichia coli ECRC102)
MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDD
EGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPR
PAQPVQQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPE
PVAEPAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPD
GSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEV
GGVVLDDQRRMMTPQKLREYQDIIREVKDANA