Protein Info for NIAGMN_18525 in Escherichia coli ECRC102

Name: yqaA
Annotation: Inner membrane protein YqaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details PF09335: SNARE_assoc" amino acids 29 to 132 (104 residues), 44.2 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 99% identical to YQAA_ECOLI: Inner membrane protein YqaA (yqaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to etw:ECSP_3636)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>NIAGMN_18525 Inner membrane protein YqaA (Escherichia coli ECRC102)
VSEALSLFSLFASSFLSATLLPGNSEVVLVAMLLSGISHPWVLVLTATMGNSLGGLTNVI
LGRFCPLRKTSRWQEKATGWLKRYGAVTLLLSWMPVVGDLLCLLAGWMRISWGPVIFFLC
LGKALRYVAVAAATVQGMMWWH