Protein Info for NIAGMN_18055 in Escherichia coli ECRC102

Name: ygcG
Annotation: TPM-phosphatase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 178 to 195 (18 residues), see Phobius details amino acids 201 to 217 (17 residues), see Phobius details amino acids 223 to 223 (1 residues), see Phobius details amino acids 229 to 239 (11 residues), see Phobius details amino acids 241 to 257 (17 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 305 to 332 (28 residues), see Phobius details PF04536: TPM_phosphatase" amino acids 23 to 149 (127 residues), 75.7 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: K06872, (no description) (inferred from 100% identity to eok:G2583_3429)

Predicted SEED Role

"FIG00639981: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>NIAGMN_18055 TPM-phosphatase domain-containing protein (Escherichia coli ECRC102)
MRIFLLLLMLCGFQVFAERLPSVTDLTGTLTTEEQTALTQQLQTLEQQNHFQVAVLVTPT
TGGKNIKLAASQRYGVYHWKPVGEKRYGEGILILVVWPEGLASMKIGHGLEEMLPPEQAA
QIVRYHMQPEFEKNNLFAGLTGGIESIAQFTHIKANLSPLDALANHLFANPQRSLPCLAW
TLLMIVAIVVLWLFASRPRRGIWMISMITPMVWFFSFQDDVIIRRVSVVCFSLLLATTCK
QRLAVVFNMCRVFPMMLTPKNKNAKVKKQKKTPQVRESGRNSLFVVMLIIIVGWCLVFAS
NKDIAFISTIIGLIDHFIGPITIAGIVLLIIVAKFTGNLKLGSGEKSNRKTGNRNAHSRS
SSRNSFRGGGGSSGGGGSSVRW