Protein Info for NIAGMN_17940 in Escherichia coli ECRC102

Name: xni
Annotation: flap endonuclease Xni

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02739: 5_3_exonuc_N
  • amino acids 35 to 172 (138 residues), 99.3 bits, E=2e-32
• PF01367: 5_3_exonuc
  • amino acids 190 to 279 (90 residues), 94.4 bits, E=5e-31

Best Hits

Swiss-Prot: 100% identical to XNI_SHIBS: Flap endonuclease Xni (xni) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K01146, protein Xni (inferred from 98% identity to ecg:E2348C_3065)

Predicted SEED Role

"DNA polymerase I (EC 2.7.7.7)" in subsystem DNA-replication or DNA Repair Base Excision (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (281 amino acids)

>NIAGMN_17940 flap endonuclease Xni (Escherichia coli ECRC102)
LRGLFPISHPAIACSSIECYPYRLIFKGVIVAVHLLIVDALNLIRRIHAVQGSPCVETCQ
HALDQLIMHSQPTHAVAVFDDENRSSGWRHQRLPDYKAGRPPMPEELHDEMPALRAAFEQ
RGVPCWSTSGNEADDLAATLAVKVTQAGHQATIVSTDKGYCQLLSPTLRIRDYFQKRWLD
APFIDKEFGVQPQQLPDYWGLAGISSSKVPGVAGIGPKSATQLLVEFQSLEGIYENLDAV
AEKWRKKLETHKEMAFLCRDIARLQTDLHIDGNLQQLRLVR