Protein Info for NIAGMN_17375 in Escherichia coli ECRC102

Name: uacT
Annotation: urate/proton symporter UacT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 423 to 443 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 29 to 409 (381 residues), 414.2 bits, see alignment E=2.3e-128 TIGR00801: uracil-xanthine permease" amino acids 29 to 440 (412 residues), 453.2 bits, see alignment E=8.7e-140 TIGR03173: xanthine permease" amino acids 33 to 443 (411 residues), 508.3 bits, see alignment E=1.4e-156

Best Hits

Swiss-Prot: 100% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2888)

MetaCyc: 100% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (482 amino acids)

>NIAGMN_17375 urate/proton symporter UacT (Escherichia coli ECRC102)
MSAIDSQLPSSSGQDRPTDEVDRILSPGKLIILGLQHVLVMYAGAVAVPLMIGDRLGLSK
EAIAMLISSDLFCCGIVTLLQCIGIGRFMGIRLPVIMSVTFAAVTPMIAIGMNPDIGLLG
IFGATIAAGFITTLLAQLIGRLMPLFPPLVTGVVITSIGLSIIQVGIDWAAGGKGNPQYG
NPVYLGISFAVLIFILLITRYAKGFMSNVAVLLGIVFGFLLSWMMNEVNLSGLHDASWFA
IVTPMSFGMPIFDPVSILTMTAVLIIVFIESMGMFLALGEIVGRKLSSHDIIRGLRVDGV
GTMIGGTFNSFPHTSFSQNVGLVSVTRVHSRWVCISSGIILILFGMVPKMAVLVASIPQF
VLGGAGLVMFGMVLATGIRILSRCNYTTNRYNLYIVAISLGVGMTPTLSHDFFSKLPAVL
QPLLHSGIMLATLSAVVLNVFFNGYQHHADLVKESVSDKDLKVRTVRMWLLMRKLKKNEH
GE