Protein Info for NIAGMN_16825 in Escherichia coli ECRC102

Name: pitA
Annotation: inorganic phosphate transporter PitA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 254 (22 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details PF01384: PHO4" amino acids 30 to 412 (383 residues), 223.1 bits, see alignment E=2.7e-70

Best Hits

Swiss-Prot: 99% identical to PITB_ECOLI: Probable low-affinity inorganic phosphate transporter 2 (pitB) from Escherichia coli (strain K12)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to ece:Z4341)

MetaCyc: 99% identical to metal phosphate:H+ symporter PitB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-114; TRANS-RXN-277; TRANS-RXN-278; TRANS-RXN0-550

Predicted SEED Role

"Low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>NIAGMN_16825 inorganic phosphate transporter PitA (Escherichia coli ECRC102)
MLNLFVGLDIYTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMQPQLAVVMAAFF
NFFGVLLGGLSVAYAIVHMLPTDLLLNMGSTHGLAMVFSMLLAAIIWNLGTWFFGLPASS
SHTLIGAIIGIGLTNALLTGSSVMDALNLREVTKIFSSLIVSPIVGLVIAGGLIFLLRRY
WSGTKKRDRIHRIPEDRKKKKGKRKPPFWTRIALIVSAAGVAFSHGANDGQKGIGLVMLV
LVGIAPAGFVVNMNASGYEITRTRDAVTNFEHYLQQHPELPQKLIAMEPPLPAASTDGAQ
VTEFHCHPGNTFDAIARVKTMLPGNMESYEPLSVSQRSQLRRIMLCISDTSAKLAKLPGV
SKEDQNLLKKLRSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVAMTIGEKPFLISYCV
PPGGEPAFPVRGYVAGLE