Protein Info for NIAGMN_16200 in Escherichia coli ECRC102

Name: yhaM
Annotation: UPF0597 protein YhaM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03313: SDH_alpha
  • amino acids 91 to 428 (338 residues), 200.5 bits, E=2.1e-63

Best Hits

Swiss-Prot: 100% identical to YHAM_ECO5E: UPF0597 protein YhaM (yhaM) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: None (inferred from 100% identity to eco:b4470)

MetaCyc: 100% identical to L-cysteine desulfidase (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]

Predicted SEED Role

"Inner membrane protein"

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• glycine betaine degradation III (4/7 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• superpathway of L-methionine salvage and degradation (5/16 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.1 or 4.4.1.28

Protein Sequence (436 amino acids)

>NIAGMN_16200 UPF0597 protein YhaM (Escherichia coli ECRC102)
MFDSTLNPLWQRYILAVQEEVKPALGCTEPISLALAAAVAAAELEGPVERVEAWVSPNLM
KNGLGVTVPGTGMVGLPIAAALGALGGNANAGLEVLKDATAQAIADAKALLAAGKVSVKI
QEPCNEILFSRAKVWNGEKWACVTIVGGHTNIVHIETHDGVVFTQQACVAEGEQESPLSV
LSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLL
AKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLAR
ALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSG
MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSM
QQTDRQIIEIMASKAR