Protein Info for NIAGMN_15630 in Escherichia coli ECRC102

Name: nanQ
Annotation: N-acetylneuraminate anomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04074: DUF386" amino acids 1 to 149 (149 residues), 140.9 bits, see alignment E=1.6e-45 TIGR00022: YhcH/YjgK/YiaL family protein" amino acids 1 to 153 (153 residues), 220.9 bits, see alignment E=3.4e-70

Best Hits

Swiss-Prot: 96% identical to YHCH_ECOLI: Uncharacterized protein YhcH (yhcH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to eoi:ECO111_4041)

MetaCyc: 96% identical to N-acetylneuraminate anomerase (Escherichia coli K-12 substr. MG1655)
RXN0-7389 [EC: 5.1.3.24]

Predicted SEED Role

"Putative sugar isomerase involved in processing of exogenous sialic acid" in subsystem Sialic Acid Metabolism

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>NIAGMN_15630 N-acetylneuraminate anomerase (Escherichia coli ECRC102)
MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEK
KAELHEQYIDIQLLLKGEERILFGTAGTARQCEEFHHEDDYQLCSAIENEQTINLKPGMF
AVFMPGEPHKPGCVVGEPGEIKKVVVKVKADLMA