Protein Info for NIAGMN_15600 in Escherichia coli ECRC102

Name: dcuC
Annotation: anaerobic C4-dicarboxylate transporter DcuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 signal peptide" amino acids 5 to 16 (12 residues), see Phobius details transmembrane" amino acids 17 to 18 (2 residues), see Phobius details amino acids 26 to 47 (22 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details amino acids 133 to 133 (1 residues), see Phobius details amino acids 135 to 173 (39 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 372 to 396 (25 residues), see Phobius details PF03606: DcuC" amino acids 2 to 405 (404 residues), 400.5 bits, see alignment E=4.3e-124 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 54 to 407 (354 residues), 596.7 bits, see alignment E=1.2e-183

Best Hits

Swiss-Prot: 98% identical to DCUD_ECOLI: Putative cryptic C4-dicarboxylate transporter DcuD (dcuD) from Escherichia coli (strain K12)

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 100% identity to ece:Z4585)

Predicted SEED Role

"Putative cryptic C4-dicarboxylate transporter DcuD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>NIAGMN_15600 anaerobic C4-dicarboxylate transporter DcuC (Escherichia coli ECRC102)
MFGIIISVIVLITMGYLILKNYKPQVVLAAGIFLMMCGVWLGLGGVLDPAKSSGYLIVDI
YNEILRMLSNRIAGLGLSIMAVGGYARYMERTGASRAMVSLLSRPLKLIRSPYIILSATY
VIGQIMAQFITSASGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIFA
AQVAGMKIATYFFHYQLPVASCVIISVAISHFFVQRAFDKKDKNINHEQAEQKALDNVPP
LYYAILPVMPLILMLGSLFLAHIGLMQSELHLVVVMLLSLTMFVEFFRKHNLRETMDDVQ
AFFDGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALVIAI
CAIVMGSGNAPFMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARGFADYCGGGRYVRNC
RRFAFCGGEADSDPHGSRFRGEYDCHNHAILLSH