Protein Info for NIAGMN_14770 in Escherichia coli ECRC102

Name: bioH
Annotation: pimeloyl-ACP methyl ester esterase BioH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR01738: pimelyl-[acyl-carrier protein] methyl ester esterase" amino acids 10 to 252 (243 residues), 393.3 bits, see alignment E=2.3e-122 PF00561: Abhydrolase_1" amino acids 15 to 242 (228 residues), 140.5 bits, see alignment E=1.2e-44 PF12146: Hydrolase_4" amino acids 16 to 214 (199 residues), 35.8 bits, see alignment E=8.3e-13 PF12697: Abhydrolase_6" amino acids 16 to 245 (230 residues), 68.8 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 100% identical to BIOH_ECO57: Pimeloyl-[acyl-carrier protein] methyl ester esterase (bioH) from Escherichia coli O157:H7

KEGG orthology group: K02170, biotin biosynthesis protein BioH (inferred from 100% identity to ecf:ECH74115_4719)

MetaCyc: 97% identical to pimeloyl-acyl carrier protein methyl ester esterase (Escherichia coli K-12 substr. MG1655)
RXN-11483 [EC: 3.1.1.85]; Carboxylesterase. [EC: 3.1.1.85, 3.1.1.1]

Predicted SEED Role

"Biotin synthesis protein BioH"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.1 or 3.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>NIAGMN_14770 pimeloyl-ACP methyl ester esterase BioH (Escherichia coli ECRC102)
MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALS
LAEMAEAVLRQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGI
KPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGL
EILKTVDLRLPLQNVPMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFIS
HPVEFRHVLVALKQRV