Protein Info for NIAGMN_14765 in Escherichia coli ECRC102

Name: gntX
Annotation: DNA utilization protein GntX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00201: comF family protein" amino acids 23 to 225 (203 residues), 270.8 bits, see alignment E=3.4e-85 PF00156: Pribosyltran" amino acids 180 to 225 (46 residues), 32.1 bits, see alignment 3.4e-12

Best Hits

Swiss-Prot: 100% identical to GNTX_ECO57: DNA utilization protein YhgH (gntX) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to eco:b3413)

Predicted SEED Role

"Competence protein F homolog, phosphoribosyltransferase domain; protein YhgH required for utilization of DNA as sole source of carbon and energy"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>NIAGMN_14765 DNA utilization protein GntX (Escherichia coli ECRC102)
MLTVPGLCWLCRMPLALGHWGICSVCSRAARTDKTLCPQCGLPATHSHLPCGRCLQKPPP
WQRLVTVADYAPPLSLLIHQLKFSRRSEIASALSRLLLLEVLHARRTTGLQLPDRIISVP
LWQRRHWRRGFNQSDLLCQPLSRWLHCQWDSEAITRTRATATQHFLSARLRRRNLKNAFR
LELPVQGRHMVIVDDVVTTGSTVAEIAQLLLRNGAATVQVWCLCRTL