Protein Info for NIAGMN_14485 in Escherichia coli ECRC102

Name: rpoH
Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02392: alternative sigma factor RpoH" amino acids 14 to 283 (270 residues), 430.4 bits, see alignment E=3.3e-133 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 48 to 281 (234 residues), 118.9 bits, see alignment E=1.8e-38 PF04542: Sigma70_r2" amino acids 53 to 122 (70 residues), 66.3 bits, see alignment E=1.7e-22 PF04545: Sigma70_r4" amino acids 228 to 280 (53 residues), 61.1 bits, see alignment E=5.8e-21

Best Hits

Swiss-Prot: 100% identical to RPOH_ECOL6: RNA polymerase sigma factor RpoH (rpoH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to eco:b3461)

MetaCyc: 100% identical to RNA polymerase sigma factor RpoH (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>NIAGMN_14485 RNA polymerase sigma factor RpoH (Escherichia coli ECRC102)
MTDKMQSLALAPVGNLDSYIRAANAWPMLSADEERALAEKLHYHGDLEAAKTLILSHLRF
VVHIARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVEMVARELGVTSKDVREMESRMAAQDM
TFDLSSDDDSDSQPMAPVLYLQDKSSNFADGIEDDNWEEQAANRLTDAMQGLDERSQDII
RARWLDEDNKSTLQELADRYGVSAERVRQLEKNAMKKLRAAIEA