Protein Info for NIAGMN_14295 in Escherichia coli ECRC102

Name: nikE
Annotation: nickel import ATP-binding protein NikE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR02793: nickel-responsive transcriptional regulator NikR" amino acids 2 to 130 (129 residues), 224.6 bits, see alignment E=1.8e-71 PF01402: RHH_1" amino acids 3 to 42 (40 residues), 44.5 bits, see alignment E=9.9e-16 PF08753: NikR_C" amino acids 54 to 127 (74 residues), 98.3 bits, see alignment E=2.3e-32

Best Hits

Swiss-Prot: 100% identical to NIKR_SHIB3: Nickel-responsive regulator (nikR) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 100% identity to eco:b3481)

Predicted SEED Role

"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>NIAGMN_14295 nickel import ATP-binding protein NikE (Escherichia coli ECRC102)
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVY
EHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRG
VRHGHLQCLPKED