Protein Info for NIAGMN_14110 in Escherichia coli ECRC102

Name: chuT
Annotation: periplasmic heme-binding protein ChuT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 53 to 281 (229 residues), 118.6 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 99% identity to ect:ECIAI39_4004)

Predicted SEED Role

"Periplasmic hemin-binding protein" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>NIAGMN_14110 periplasmic heme-binding protein ChuT (Escherichia coli ECRC102)
MPRIITRPFLFSPLTLCISAVASAAKTAVKRKKLFTAVLALSWAFSVTAAERIVVAGGSL
TELIYAMGAGERVVGVDETTSYPPETAKLPHIGYWKQLSSEGILSLRPDSVITWQDAGPQ
IVLDQLRAQKVNVVTLPRVPATLQQMYANIRQLAKTLQVPEQGEALVTQISQRLERVQQN
VATKKAPVKAMFILSAGGSAPQVAGKGSVADAILSLAGAENVATHQQYKSYSAESLIAAN
PEVIVVTSQMVDGDINRLRSIAGITHTAAWKNQRIITVDQNLILGMGPRIADVVESLHQQ
LWPQ