Protein Info for NIAGMN_13995 in Escherichia coli ECRC102

Name: yhjC
Annotation: Uncharacterized HTH-type transcriptional regulator YhjC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00126: HTH_1" amino acids 29 to 86 (58 residues), 69.4 bits, see alignment E=2e-23 PF03466: LysR_substrate" amino acids 114 to 317 (204 residues), 145.1 bits, see alignment E=2e-46

Best Hits

Swiss-Prot: 98% identical to YHJC_ECOLI: Uncharacterized HTH-type transcriptional regulator YhjC (yhjC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecs:ECs4401)

Predicted SEED Role

"LysR family transcriptional regulator YhjC" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>NIAGMN_13995 Uncharacterized HTH-type transcriptional regulator YhjC (Escherichia coli ECRC102)
MLEKIINNAICALLFRCEQQSVKEMDKIHAMQLFIKVAELESFSRAADFFALPKGSVSRQ
IQALEHQLGTQLLQRTTRRVKLTPEGMTYYQRAKDVLSNLNELDGLFQQDATSISGKLRI
DIPPGIAKSLLLPHLSEFLYQHPGIELELSSHDRPVDILHDGFDCVIRTGALPEDGVIAR
PLGKLTMVNCASPHYLTRFGYPQNPDDLTSHAIVRYTPHLGVHPLGFEVASVNGVQWFKS
GGMLTVNSSENYLAAGLAGLGIIQIPRIAVREALRAGRLIEVLPGYRAEPLSLSLVYPQR
RELSRRVNLFMQWLAGVMKEYLD