Protein Info for NIAGMN_13585 in Escherichia coli ECRC102

Name: yibH
Annotation: Inner membrane protein YibH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 28 to 49 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 12 to 367 (356 residues), 38 bits, see alignment E=2.6e-13 PF13533: Biotin_lipoyl_2" amino acids 64 to 110 (47 residues), 39.9 bits, see alignment 5.5e-14 PF16576: HlyD_D23" amino acids 208 to 301 (94 residues), 31.8 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 100% identical to YIBH_ECO57: Inner membrane protein YibH (yibH) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b3597)

Predicted SEED Role

"Multidrug resistance protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>NIAGMN_13585 Inner membrane protein YibH (Escherichia coli ECRC102)
MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA
VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL
RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG
SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY
AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV
VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM
RKVLLRMTSWMHYLYLDH