Protein Info for NIAGMN_13415 in Escherichia coli ECRC102

Name: rfaG
Annotation: Lipopolysaccharide core biosynthesis protein RfaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13439: Glyco_transf_4
  • amino acids 14 to 173 (160 residues), 35.5 bits, E=2.1e-12
• PF20706: GT4-conflict
  • amino acids 159 to 350 (192 residues), 44 bits, E=3.2e-15
• PF00534: Glycos_transf_1
  • amino acids 183 to 350 (168 residues), 137.9 bits, E=5.3e-44
• PF13692: Glyco_trans_1_4
  • amino acids 199 to 332 (134 residues), 63.6 bits, E=5e-21

Best Hits

Swiss-Prot: 90% identical to RFAG_ECOLI: Lipopolysaccharide core biosynthesis protein RfaG (rfaG) from Escherichia coli (strain K12)

KEGG orthology group: K02844, UDP-glucose:(heptosyl)LPS alpha-1,3-glucosyltransferase [EC: 2.4.1.-] (inferred from 99% identity to sdy:SDY_4061)

MetaCyc: 90% identical to lipopolysaccharide glucosyltransferase I (Escherichia coli K-12 substr. MG1655)
2.4.1.M73 [EC: 2.4.1.M73]; 2.4.1.M73 [EC: 2.4.1.M73]

Predicted SEED Role

"UDP-glucose:(heptosyl) LPS alpha1,3-glucosyltransferase WaaG (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (22/25 steps found)
• lipid A-core biosynthesis (Salmonella) (9/10 steps found)
• lipid A-core biosynthesis (E. coli K-12) (7/10 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.M73

Protein Sequence (374 amino acids)

>NIAGMN_13415 Lipopolysaccharide core biosynthesis protein RfaG (Escherichia coli ECRC102)
MIVAFCLYKYFPFGGLQRDFMRIAQTVAARGHHVRVYTQSWEGECPDVFELIKVPVKSHT
NHGRNAEYFAWVQKHLREHPVDKVVGFNKMPGLDVYYAADVCYAEKVAQEKGFFYHLTSR
YRHYAAFERATFEQGKPTQLLMLTDKQIADFQKHYQTEAERFHILPPGIYPDRKYSQQPA
NSREIFRKKNGITEQQYLLLQVGSDFTRKGVDRSIEALASLPDSLRHNTLLYVVGQDKPR
KFEALAEKRGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTT
AVCGYAHYIVDANCGEAIAEPFRQETLNEILRKALTQSSLRQAWAENARHYADTQDLYSL
PEKAADIITGGLDG