Protein Info for NIAGMN_13360 in Escherichia coli ECRC102

Name: pyrE
Annotation: Orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 10 to 187 (178 residues), 239.1 bits, E=1.2e-75
• PF00156: Pribosyltran
  • amino acids 49 to 159 (111 residues), 35.4 bits, E=3.4e-13

Best Hits

Swiss-Prot: 100% identical to PYRE_ECO5E: Orotate phosphoribosyltransferase (pyrE) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 99% identity to eco:b3642)

MetaCyc: 99% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Protein Sequence (213 amino acids)

>NIAGMN_13360 Orotate phosphoribosyltransferase (Escherichia coli ECRC102)
MKPYQRQFIEFALGKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDS
GLEFDLLFGPAYKGIPIATTTAVALAEHHDLDLPYCFNRKEAKDHGEGGNLVGSALQGRV
MLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERGRGEISAIQEVERDYNCKVIS
IITLKDLIAYLEEKPEMAEHLAAVKAYREEFGV