Protein Info for NIAGMN_11280 in Escherichia coli ECRC102

Name: btuB
Annotation: TonB-dependent vitamin B12 receptor BtuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01779: TonB-dependent vitamin B12 receptor" amino acids 2 to 614 (613 residues), 907.9 bits, see alignment E=1.7e-277 PF07715: Plug" amino acids 41 to 146 (106 residues), 106.5 bits, see alignment E=1.1e-34 PF00593: TonB_dep_Rec" amino acids 171 to 588 (418 residues), 153.9 bits, see alignment E=1.3e-48

Best Hits

Swiss-Prot: 100% identical to BTUB_ECO57: Vitamin B12 transporter BtuB (btuB) from Escherichia coli O157:H7

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ecs:ECs4897)

MetaCyc: 98% identical to cobalamin outer membrane transporter (Escherichia coli K-12 substr. MG1655)
RXN0-1565; TRANS-RXN0-283

Predicted SEED Role

"Outer membrane vitamin B12 receptor BtuB" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (614 amino acids)

>NIAGMN_11280 TonB-dependent vitamin B12 receptor BtuB (Escherichia coli ECRC102)
MIKKASLLTACSVTAFSAWAQDTSPDTLVVTANRFEQPRSTVLAPTTVVTRQDIDRWQST
SVNDVLRRLPGVDITQNGGSGQLSSIFIRGTNASHVLVLIDGVRLNLAGGSGSADLSQFP
IALVQRVEYIRGPRSAVYGSDAIGGVVNIITTRDEPGTEISAGWGSNSYQNYDVSTQQQL
GDKTRVTLLGDYAHTHGYDVVAYGNTGTQAQPDNDGFLSKTLYGALEHNFTDAWSGFVRG
YGYDNRTNYDAYYSPGSPLVDTRKLYSQSWDAGLRYNGELIKSQLITSYSHSKDYNYDPH
YGRYDSSATLDEMKQYTVQWANNIIIGHGNVGAGVDWQKQSTAPGTAYVKDGYDQRNTGI
YLTGLQQVGDFTFEGAARSDDNSQFGRHGTWQTSAGWEFIEGYRFIASYGTSYKAPNLGQ
LYGFYGNPNLDPEKSKQWEGAFEGLTAGVNWRISGYRNDVSDLIDYDDHTLKYYNEGKAR
IKGVEATANFDTGPLTHTVSYDYVDARNAITDTPLLRRAKQQVKYQLDWQLYDFDWGITY
QYLGTRYDKDYSSYPYQTVKMGGVSLWDLAVAYPVTSHLTVRGKIANLFDKDYETVYGYQ
TAGREYTLSGSYTF