Protein Info for NIAGMN_10955 in Escherichia coli ECRC102

Name: manX
Annotation: PTS sorbose transporter subunit IIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00824: PTS system, mannose/fructose/sorbose family, IIA component
  • amino acids 1 to 114 (114 residues), 148 bits, E=6e-48
• PF03610: EIIA-man
  • amino acids 7 to 113 (107 residues), 60.6 bits, E=7.8e-21

Best Hits

Swiss-Prot: 72% identical to PTRA_KLEPN: PTS system sorbose-specific EIIA component (sorF) from Klebsiella pneumoniae

KEGG orthology group: K02812, PTS system, sorbose-specific IIA component [EC: 2.7.1.69] (inferred from 94% identity to sbc:SbBS512_E4522)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Protein Sequence (135 amino acids)

>NIAGMN_10955 PTS sorbose transporter subunit IIA (Escherichia coli ECRC102)
MVNAIFCAHGKLACAMLESVQMVYGNANVEAVEFVPGENAGDIVAKLEKLVSIHNQNEWL
IAVDLQCGSPWNAAAMLAMRNPRLRVISGLSLPLALELVDNQDSMNVDELCEHLTQIAKQ
TCVVWKQLATTEEDF