Protein Info for NIAGMN_10565 in Escherichia coli ECRC102

Name: rbsB
Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 29 to 234 (206 residues), 55.4 bits, see alignment E=6.7e-19 PF13407: Peripla_BP_4" amino acids 30 to 285 (256 residues), 192.4 bits, see alignment E=1.1e-60

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 100% identity to sdy:SDY_4130)

Predicted SEED Role

"ABC transport system, periplasmic substrate-binding protein Z5689"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>NIAGMN_10565 transcriptional regulator (Escherichia coli ECRC102)
MRLKPLVTALCAGALLAAAPFAQAKELKSIGVTVGDLANPFFVQITKGAELEARKLAGDN
VKVTLVSSGYDLGQQVSQIDNFIAANVDMIILNAADSKGIGPAVKRAKDAGIVVVAVDVA
AEGADATITSDNTQAGEMACKYITDRLKGKGNVVIINGPPVSAVQNRVEGCQTEFKRHPD
IKVLSDNQNAKGSREGGLEVMTGLLAANPKIDGVFAINDPTAIGADLAAKQAQRNEFFIV
GVDGSPDAEEALKRENSLFVATPAQDPQVMAAKAVEIGYDILQGKPAPKEPVLIPVTMID
KNNVGNYKGWTVK