Protein Info for NIAGMN_10250 in Escherichia coli ECRC102

Name: yjeI
Annotation: Uncharacterized protein YjeI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13698: DUF4156" amino acids 23 to 115 (93 residues), 115.1 bits, see alignment E=8e-38

Best Hits

Swiss-Prot: 100% identical to YJEI_SHIFL: Uncharacterized protein YjeI (yjeI) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b4144)

Predicted SEED Role

"probable membrane protein yjeI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (117 amino acids)

>NIAGMN_10250 Uncharacterized protein YjeI (Escherichia coli ECRC102)
MHVKYLAGIVGAALLMAGCSSSNELSAAGQSVRIVDEQPGAECQLIGTATGKQSNWLSGQ
HGEEGGSMRGAANDLRNQAAAMGGNVIYGISSPSQGMLSSFVPTDSQIIGQVYKCPN