Protein Info for NIAGMN_09885 in Escherichia coli ECRC102

Name: cysQ
Annotation: 3'(2'),5'-bisphosphate nucleotidase CysQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01331: 3'(2'),5'-bisphosphate nucleotidase
  • amino acids 1 to 244 (244 residues), 378 bits, E=1.1e-117
• PF00459: Inositol_P
  • amino acids 5 to 233 (229 residues), 176.4 bits, E=4.3e-56

Best Hits

Swiss-Prot: 100% identical to CYSQ_ECO57: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Escherichia coli O157:H7

KEGG orthology group: K03677, CysQ protein (inferred from 99% identity to eco:b4214)

MetaCyc: 99% identical to 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli K-12 substr. MG1655)
3'(2'),5'-bisphosphate nucleotidase. [EC: 3.1.3.7]

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Protein Sequence (246 amino acids)

>NIAGMN_09885 3'(2'),5'-bisphosphate nucleotidase CysQ (Escherichia coli ECRC102)
MLDQVCQLARNAGDAIMQVYDGAKPMDVVSKADNSPVTAADIAAHTVIMDGLRTLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIDHGKPILGVVYAPVM
NVMYSAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHADAELKEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHDWQGKPLDYTPRESFLNPG
FRVSIY