Protein Info for NIAGMN_09475 in Escherichia coli ECRC102

Name: nanM
Annotation: N-acetylneuraminate epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03547: mutatrotase, YjhT family
  • amino acids 22 to 359 (338 residues), 478.6 bits, E=5.6e-148
• PF13854: Kelch_5
  • amino acids 74 to 115 (42 residues), 23.9 bits, 8.1e-09
• PF13418: Kelch_4
  • amino acids 74 to 124 (51 residues), 39.2 bits, 1.7e-13
• PF01344: Kelch_1
  • amino acids 74 to 120 (47 residues), 35.6 bits, 1.6e-12
• PF13964: Kelch_6
  • amino acids 74 to 120 (47 residues), 36.3 bits, 1.2e-12
• PF07646: Kelch_2
  • amino acids 74 to 120 (47 residues), 31.7 bits, 3.1e-11
• PF13415: Kelch_3
  • amino acids 85 to 131 (47 residues), 29.1 bits, 2.7e-10

Best Hits

Swiss-Prot: 100% identical to NANM_ECO57: N-acetylneuraminate epimerase (nanM) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5814)

MetaCyc: 98% identical to N-acetylneuraminate mutarotase (Escherichia coli K-12 substr. MG1655)
RXN0-5329 [EC: 5.1.3.24]

Predicted SEED Role

"Sialic acid-induced transmembrane protein YjhT(NanM), possible mutarotase" in subsystem Sialic Acid Metabolism

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (22/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (6/6 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation I (4/4 steps found)
• N-acetylneuraminate and N-acetylmannosamine degradation II (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.24

Protein Sequence (368 amino acids)

>NIAGMN_09475 N-acetylneuraminate epimerase (Escherichia coli ECRC102)
MNKTITALAILMASFAANASVLPETPVPFKSGTGAIDNDTVYIGLGSAGTAWYKLETQAK
DKKWTALAAFPGGPRDQATSAFIDGNLYVFGGIGKNSEGLTQVFNDVHKYNPKTNSWVKL
ISHAPMGMAGHVTFVHNGKAYVTGGVNQNIFNGYFEDLNEAGKDSTAVDKINAHYFDKKA
EDYFFNKFLLSFDPSTQQWSYAGESPWYGTAGAAVVNKGDKTWLINGEAKPGLRTDAVFE
LDFTGNNLKWNRLAPVSSPDGVAGGFAGISNDSLIFAGGAGFKGSRENYQNGKNYAHEGL
KKSYSTDIHLWHNGKWDKSGELSQGRAYGVSLPWNNSLLIIGGETAGGKAVTDSVLISVK
DNKVTVQN