Protein Info for NIAGMN_09130 in Escherichia coli ECRC102

Name: prfC
Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 TIGR00503: peptide chain release factor 3" amino acids 3 to 529 (527 residues), 1096 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 13 to 277 (265 residues), 163 bits, see alignment E=1.2e-51 TIGR00231: small GTP-binding protein domain" amino acids 15 to 156 (142 residues), 65.1 bits, see alignment E=6.8e-22 PF01926: MMR_HSR1" amino acids 17 to 143 (127 residues), 22.9 bits, see alignment E=1.5e-08 PF03144: GTP_EFTU_D2" amino acids 314 to 380 (67 residues), 50.4 bits, see alignment E=4.9e-17 PF16658: RF3_C" amino acids 387 to 514 (128 residues), 159.4 bits, see alignment E=8.2e-51

Best Hits

Swiss-Prot: 100% identical to RF3_ECOSM: Peptide chain release factor 3 (prfC) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to eco:b4375)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>NIAGMN_09130 peptide chain release factor 3 (Escherichia coli ECRC102)
MTLSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSNQHAKSDWM
EMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVE
DRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITWPIGCGKLFK
GVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNE
FDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFV
FKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAGDRSHVEEAY
PGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPLKQKQLLKGLVQLS
EEGAVQVFRPISNNDLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECADAK
KFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH