Protein Info for NIAGMN_09115 in Escherichia coli ECRC102

Name: yjjU
Annotation: Uncharacterized protein YjjU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF01734: Patatin" amino acids 27 to 195 (169 residues), 86.9 bits, see alignment E=2.1e-28 PF19890: DUF6363" amino acids 234 to 305 (72 residues), 77.5 bits, see alignment E=5.6e-26

Best Hits

Swiss-Prot: 99% identical to YJJU_ECOLI: Uncharacterized protein YjjU (yjjU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b4377)

Predicted SEED Role

"FIG00638703: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>NIAGMN_09115 Uncharacterized protein YjjU (Escherichia coli ECRC102)
VGQRIPVTLGNIAPLSLRPFQPGRIALVCEGGGQRGIFTAGVLDEFMRAQFNPFDLYLGT
SAGAQNLSAYICNQPGYARKVIMRYTTKREFFDPLRFVRGGNLIDLDWLVEATASQMPLQ
MDTAARLFDSGKSFYMCACRQDDYAPNYFLPTKQNWLDVIRASSAIPGFYRSGVSLEGIN
YLDGGISDAIPVKEAARQGAKTLVVIRTVPSQMYYTPQWFKRMERWLGDSSLQPLVNLVQ
HHETSYRDIQQFIEKPPGKLRIFEIYPPKPLHSIALGSRIPALREDYKLGRLCGRYFLAT
VGKLLTEKAPLTRHLVPVVTPESIVIPPAPVANDTLVAEVSDAPQANDPTFNNEDLA