Protein Info for NIAGMN_08990 in Escherichia coli ECRC102

Name: creB
Annotation: two-component system response regulator CreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00072: Response_reg" amino acids 6 to 116 (111 residues), 95.5 bits, see alignment E=2.3e-31 PF00486: Trans_reg_C" amino acids 151 to 226 (76 residues), 82.1 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 98% identical to CREB_ECOLI: Transcriptional regulatory protein CreB (creB) from Escherichia coli (strain K12)

KEGG orthology group: K07663, two-component system, OmpR family, catabolic regulation response regulator CreB (inferred from 98% identity to eco:b4398)

Predicted SEED Role

"Two-component response regulator CreB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>NIAGMN_08990 two-component system response regulator CreB (Escherichia coli ECRC102)
MQRETVWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARQQVPDVMILDVGLPDI
SGFELCRQLLALHPALPVLFLTARSEEVDRLLGLEIGADDYVAKPFSPREVCARVRTLLR
RVKKFSTPSPVIRIGHFELNEPAAQISWFDTPLTLTRYEFLLLKTLLKSPGRVWSRQQLM
DIVWEDAQDTYDRTVDTHIKTLRAKLRAINPDLSPINTHRGMGYSLRSL