Protein Info for NIAGMN_08205 in Escherichia coli ECRC102

Name: pcnB
Annotation: polynucleotide adenylyltransferase PcnB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 TIGR01942: poly(A) polymerase" amino acids 20 to 447 (428 residues), 522.9 bits, see alignment E=2.9e-161 PF01743: PolyA_pol" amino acids 51 to 182 (132 residues), 139.8 bits, see alignment E=9.4e-45 PF12627: PolyA_pol_RNAbd" amino acids 209 to 270 (62 residues), 72.9 bits, see alignment E=2.1e-24 PF12626: PolyA_pol_arg_C" amino acids 327 to 446 (120 residues), 137.5 bits, see alignment E=3.4e-44

Best Hits

Swiss-Prot: 100% identical to PCNB_ECOLI: Poly(A) polymerase I (pcnB) from Escherichia coli (strain K12)

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 100% identity to eco:b0143)

MetaCyc: 100% identical to poly(A) polymerase I (Escherichia coli K-12 substr. MG1655)
Polynucleotide adenylyltransferase. [EC: 2.7.7.19]

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>NIAGMN_08205 polynucleotide adenylyltransferase PcnB (Escherichia coli ECRC102)
VLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLNKAGYEAWLVGGGVRD
LLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGNV
SDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGV
IRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEESL
KLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLKNTDTRIHNDMR
VNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSLAIPKRLTTLTR
DIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEVERNAELQRLVKWWGEFQVSAP
PDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA