Protein Info for NIAGMN_08010 in Escherichia coli ECRC102

Name: lpxD
Annotation: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD" amino acids 8 to 329 (322 residues), 436.4 bits, see alignment E=2.7e-135 PF04613: LpxD" amino acids 22 to 88 (67 residues), 76.5 bits, see alignment E=1.7e-25 PF00132: Hexapep" amino acids 110 to 144 (35 residues), 41.5 bits, see alignment 1.1e-14 amino acids 145 to 179 (35 residues), 34.1 bits, see alignment 2.2e-12 amino acids 222 to 255 (34 residues), 30.3 bits, see alignment 3.5e-11 PF14602: Hexapep_2" amino acids 112 to 143 (32 residues), 30 bits, see alignment 5.2e-11 amino acids 134 to 180 (47 residues), 15.6 bits, see alignment 1.6e-06

Best Hits

Swiss-Prot: 100% identical to LPXD_SHIFL: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (lpxD) from Shigella flexneri

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b0179)

MetaCyc: 100% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli K-12 substr. MG1655)
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-RXN [EC: 2.3.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>NIAGMN_08010 UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli ECRC102)
MPSIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVV
MTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGA
NAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGA
DGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQCQIAHN
VVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGV
YSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD