Protein Info for NIAGMN_07930 in Escherichia coli ECRC102

Name: yaeF
Annotation: YaeF family permuted papain-like enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF00877: NLPC_P60" amino acids 29 to 121 (93 residues), 24.5 bits, see alignment E=2.2e-09 PF05708: Peptidase_C92" amino acids 65 to 156 (92 residues), 36.6 bits, see alignment E=4.9e-13

Best Hits

Swiss-Prot: 97% identical to YAEF_ECOLI: Probable lipoprotein peptidase YaeF (yaeF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eok:G2583_0197)

Predicted SEED Role

"Uncharacterized lipoprotein yaeF precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>NIAGMN_07930 YaeF family permuted papain-like enzyme (Escherichia coli ECRC102)
MDKPKAYCRLLLPCFLLLSACTVDISQPDSSATAVDAEAKTWAVKFQHQSSFTEQSIKEI
TVPDLKPGDLLFSSSLEVTSFGIRVFSTSSVSHVAIYLGENNVAEATGAGVQIVSLKKAM
KHSDKLFVLRVPDLTPQQATEITAFANKIKDSGYNYRGIVEFIPFMVTRQMCSLNPFSED
FRQQCVSGLAKAQLSSVVEGDKKSWFCSEFVTDAFAKAGHPLTLAQSGWISPADLMHMRI
GDVSAFKPETQLQYVGHLKPGIYIKAGRFVGLTR