Protein Info for NIAGMN_06955 in Escherichia coli ECRC102

Name: prpB
Annotation: methylisocitrate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 TIGR02317: methylisocitrate lyase" amino acids 7 to 290 (284 residues), 455.9 bits, see alignment E=2.5e-141 PF13714: PEP_mutase" amino acids 10 to 250 (241 residues), 153.4 bits, see alignment E=8.4e-49 PF00463: ICL" amino acids 81 to 182 (102 residues), 52 bits, see alignment E=4.4e-18

Best Hits

Swiss-Prot: 99% identical to PRPB_ECOLI: 2-methylisocitrate lyase (prpB) from Escherichia coli (strain K12)

KEGG orthology group: K03417, methylisocitrate lyase [EC: 4.1.3.30] (inferred from 100% identity to eok:G2583_0442)

MetaCyc: 99% identical to 2-methylisocitrate lyase (Escherichia coli K-12 substr. MG1655)
Methylisocitrate lyase. [EC: 4.1.3.30]

Predicted SEED Role

"Methylisocitrate lyase (EC 4.1.3.30)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.1.3.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>NIAGMN_06955 methylisocitrate lyase (Escherichia coli ECRC102)
MSLHSPGKAFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAAGSLGLPDLG
ISTLDDVLTDIRRITDVCSLPLLVDADIGFGSSAFNVARTVKSMIKAGAAGLHIEDQVGA
KRCGHRPNKAIVSKEEMVDRIRAAVDAKTDPDFVIMARTDALAVEGLDAAIERAQAYVEA
GAEMLFPEAITELAMYRQFADAVQVPILANITEFGATPLFTTDELRSAHVAMALYPLSAF
RAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNELYESINYYHYEEKLDDLFVRSQAK