Protein Info for NIAGMN_06845 in Escherichia coli ECRC102

Name: mhpR
Annotation: DNA-binding transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF09339: HTH_IclR" amino acids 53 to 103 (51 residues), 52.4 bits, see alignment 9.4e-18 PF13412: HTH_24" amino acids 58 to 100 (43 residues), 23.3 bits, see alignment 9.8e-09 PF12802: MarR_2" amino acids 58 to 105 (48 residues), 30.1 bits, see alignment 1.1e-10 PF01614: IclR" amino acids 173 to 295 (123 residues), 45.5 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 99% identical to MHPR_ECOLI: DNA-binding transcriptional activator MhpR (mhpR) from Escherichia coli (strain K12)

KEGG orthology group: K05818, IclR family transcriptional regulator, mhp operon transcriptional activator (inferred from 99% identity to ebr:ECB_00300)

Predicted SEED Role

"Mhp operon transcriptional activator" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>NIAGMN_06845 DNA-binding transcriptional regulator (Escherichia coli ECRC102)
MIFYCALSIERVFSATIKTCPNVHQVHNVVLTIEMSINMQNNEQTEYKTVRGLTRGLMLL
NMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPSDDSFRLTIKVRQLSEG
FRDEQWISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLP
LLKTASGLTWLAFCPEQERKELIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYR
GWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVES
QAILVAGRRSGVHLR