Protein Info for NIAGMN_05830 in Escherichia coli ECRC102

Name: fimZ
Annotation: fimbria biosynthesis transcriptional regulator FimZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 PF00072: Response_reg" amino acids 6 to 118 (113 residues), 96 bits, see alignment E=1.6e-31 PF00196: GerE" amino acids 149 to 204 (56 residues), 81.4 bits, see alignment E=2.8e-27

Best Hits

Swiss-Prot: 100% identical to FIMZ_ECO57: Fimbriae Z protein (fimZ) from Escherichia coli O157:H7

KEGG orthology group: K07688, two-component system, NarL family, response regulator, fimbrial Z protein, FimZ (inferred from 100% identity to eco:b0535)

Predicted SEED Role

"Transcriptional regulator of fimbriae expression FimZ (LuxR/UhpA family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>NIAGMN_05830 fimbria biosynthesis transcriptional regulator FimZ (Escherichia coli ECRC102)
MKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYLRTRPVDLIIMDIDLP
GTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMI
LSGYTFFPSETLNYIKSNKCSTNSSTVTVLSNREVTILRYLVSGLSNKEIADKLLLSNKT
VSAHKSNIYGKLGLHSIVELIDYAKLYELI