Protein Info for NIAGMN_05390 in Escherichia coli ECRC102

Name: lptE
Annotation: LPS assembly lipoprotein LptE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04390: LptE
  • amino acids 41 to 159 (119 residues), 66.4 bits, E=1.9e-22

Best Hits

Swiss-Prot: 100% identical to LPTE_ECO57: LPS-assembly lipoprotein LptE (lptE) from Escherichia coli O157:H7

KEGG orthology group: K03643, LPS-assembly lipoprotein (inferred from 99% identity to ect:ECIAI39_0616)

MetaCyc: 95% identical to lipopolysaccharide assembly protein LptE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (193 amino acids)

>NIAGMN_05390 LPS assembly lipoprotein LptE (Escherichia coli ECRC102)
VRYLATLLLSLAVLITAGCGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGV
ELLDKETTRKDVPSLRLGAVSISQDTASVFRNGQTAEYQMVMTVSASVLIPGRDIYPIST
KVFRSFFDNPQMALAKDNEQEMIIKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDT
PATPARVSTTLGN