Protein Info for NIAGMN_05290 in Escherichia coli ECRC102

Name: ybeY
Annotation: rRNA maturation RNase YbeY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF02130: YbeY" amino acids 20 to 142 (123 residues), 133.5 bits, see alignment E=2.2e-43 TIGR00043: rRNA maturation RNase YbeY" amino acids 40 to 144 (105 residues), 124.7 bits, see alignment E=8.7e-41

Best Hits

Swiss-Prot: 100% identical to YBEY_ECO57: Endoribonuclease YbeY (ybeY) from Escherichia coli O157:H7

KEGG orthology group: K07042, probable rRNA maturation factor (inferred from 99% identity to eco:b0659)

Predicted SEED Role

"Metal-dependent hydrolase YbeY, involved in rRNA and/or ribosome maturation and assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>NIAGMN_05290 rRNA maturation RNase YbeY (Escherichia coli ECRC102)
MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESHSLNLTYRG
KDKPTNVLSFPFEVPPGMEMSLLGDLVICRQMVEKEAQEQGKPLEAHWAHMVVHGSLHLL
GYDHIEDDEAEEMEALETEIMLALGYEDPYIAEKE