Protein Info for NIAGMN_04915 in Escherichia coli ECRC102

Name: glmL
Annotation: methylaspartate mutase accessory protein GlmL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF13941: MutL" amino acids 3 to 456 (454 residues), 459.8 bits, see alignment E=4.7e-142 TIGR01319: conserved hypothetical protein" amino acids 6 to 461 (456 residues), 898.3 bits, see alignment E=5.1e-275

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_0831)

Predicted SEED Role

"Putative glutamate mutase L"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>NIAGMN_04915 methylaspartate mutase accessory protein GlmL (Escherichia coli ECRC102)
MQIVSVDIGSTWTKAALFTREGDALTLVNHVLTPTTTHHLAKGFFSSLNQVLNVDNALPL
LNSGEVALKYSSSAKGGLAVAAMGLVPSITLETAKVTAHSAGAKIAQYYAYKLNRRDIQA
LEETQPDILLFTGGTDGGEESYGLNNARVLAESKLDCAIIYAGNRDIQDEVQEILGHKDL
TIVDNVLPDLDHPNPVAARQAICDIFLKRIVKGKGLDVIVDKTGEEPMPTPWTVFELVKA
ISNVDHSWKEFMLIDMGGATTDVYSACANTLSPDTVLHGVPEPFVKRTVEGDLGMRVSAV
VVGESAKELVNVNFAQQPAQLDAFYHYLRHLVAHPDYLPANAEEKYFDTVLAGLCVGYAT
ERHAGTKKEVCTCVGNVDLQMGRDLTTVRKVVGSGGWLSRASQFDMHHWLKYRELNDDGK
RILLPTEFEYYRDSRGLLPLLANVARVDPLAAARTSIQCLTL