Protein Info for NIAGMN_04290 in Escherichia coli ECRC102
Annotation: PKHD-type hydroxylase YbiX
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YBIX_ECO5E: PKHD-type hydroxylase YbiX (ybiX) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K07336, PKHD-type hydroxylase [EC: 1.14.11.-] (inferred from 100% identity to ece:Z1025)Predicted SEED Role
"Iron-uptake factor PiuC" in subsystem Transport of Iron
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.14.11.-
Use Curated BLAST to search for 1.14.11.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (227 amino acids)
>NIAGMN_04290 PKHD-type hydroxylase YbiX (Escherichia coli ECRC102) MYHIPGVLSPQDVARFREQLEQAEWVDGRVTTGAQGAQVKNNQQVDTRSTLYAALQNEVL NAVNQHALFFAAALPRTLSTPLFNRYQNNETYGFHVDGAVRSHPQNGWMRTDLSATLFLS DPQSYDGGELVVNDTFGQHRVKLPAGDLVLYPSSSLHCVTPVTRGVRVASFIWIQSMIRD DKKRAMLFELDKNIQNIQSLKSRYGENEEILSLLNLYHNLLREWSEI