Protein Info for NIAGMN_04140 in Escherichia coli ECRC102

Name: gsiB
Annotation: glutathione ABC transporter substrate-binding protein GsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00496: SBP_bac_5" amino acids 71 to 429 (359 residues), 343.6 bits, see alignment E=7.5e-107

Best Hits

Swiss-Prot: 100% identical to GSIB_ECO57: Glutathione-binding protein GsiB (gsiB) from Escherichia coli O157:H7

KEGG orthology group: K13889, glutathione transport system substrate-binding protein (inferred from 100% identity to eco:b0830)

MetaCyc: 100% identical to glutathione ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (512 amino acids)

>NIAGMN_04140 glutathione ABC transporter substrate-binding protein GsiB (Escherichia coli ECRC102)
MARAVHRSGLVALGIATALMASCAFAAKDVVVAVGSNFTTLDPYDANDTLSQAVAKSFYQ
GLFGLDKEMKLKNVLAESYTVSDDGITYTVKLREGIKFQDGTDFNAAAVKANLDRASDPA
NHLKRYNLYKNIAKTEAIDPTTVKITLKQPFSAFINILAHPATAMISPAALEKYGKEIGF
HPVGTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSITWRPVADNNTRAAMLQTGEAQF
AFPIPYEQAALLEKNKNIELMASPSIMQRYISMNVTQKPFDNPKVREALNYAINRPALVK
VAFAGYATPATGVVPPSIAYAQSYKPWPYDPVKARELLKEAGYPNGFSTTLWSSHNHSTA
QKVLQFTQQQLAQVGIKAQVTAMDAGQRAAEVEGKGQKESGVRMFYTGWSASTGEADWAL
SPLFASQNWPPTLFNTAFYSNKQVDDFLAQALKTNDPAEKTRLYKAAQDIIWQESPWIPL
VVEKLVSAHSKNLTGFWIMPDTGFSFEDADLQ