Protein Info for NIAGMN_03960 in Escherichia coli ECRC102

Name: artJ
Annotation: ABC transporter substrate-binding protein ArtJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01096: lysine-arginine-ornithine-binding periplasmic protein
  • amino acids 4 to 241 (238 residues), 299.6 bits, E=9.1e-94
• PF00497: SBP_bac_3
  • amino acids 23 to 242 (220 residues), 236.5 bits, E=1.2e-74

Best Hits

Swiss-Prot: 97% identical to ARTJ_ECOLI: ABC transporter arginine-binding protein 1 (artJ) from Escherichia coli (strain K12)

KEGG orthology group: K09996, arginine transport system substrate-binding protein (inferred from 100% identity to ece:Z1090)

MetaCyc: 97% identical to L-arginine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine ABC transporter, periplasmic arginine-binding protein ArtJ" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Protein Sequence (243 amino acids)

>NIAGMN_03960 ABC transporter substrate-binding protein ArtJ (Escherichia coli ECRC102)
MKKLVLAALLASCAFGASAAEKINFGVSATYPPFESMDANNQIVGFDIDLAKALCKQMQA
ECTFTNHAFDSLIPSLKFRKYDAVISGMDITPDRSKQVSFTTPYYENSAVVIAKKDTYKT
FADLKGKRIGMENGTTHQKYIQDQHPEVKTVSYDSYQNAFIDLKNSRIDGVFGDTAVVNE
WLKTNPQLGVATEKVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQQISDQW
FPQ